PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G130442_P01
Common NameHB97, HDZIV5_OCL5, ocl5a, ZEAMMB73_171983, Zm.95348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 796aa    MW: 85608.5 Da    PI: 5.6201
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G130442_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20105161157
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                        +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  GRMZM2G130442_P01 105 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 161
                        688999************************************************995 PP

2START194.74.3e-613075291206
                        HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SE CS
              START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlak 78 
                        ela +a++el+++a  ++ +W   +      ++++++e++++f+ + +      + ea+r+s+vv+m++  l e+l+d ++    ++  + +
  GRMZM2G130442_P01 307 ELAVAAMDELLRMARPDALLWGGGAsagaqqQQLDEEEYVRTFPAGLGprqygLRPEASRDSAVVIMTCDSLIEILMDANRfaaVFSSIVSR 398
                        57899****************9988889***************8877799999999************************88888888888* PP

                        EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
              START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                        a+t+ev+s+g      galq+m++e+q++splvp R+++fvRy++  ++g+w++vdvS+ds ++ p    v++++++pSg+li++++ng+sk
  GRMZM2G130442_P01 399 ASTHEVLSTGvagsynGALQVMSMEFQVPSPLVPtRESYFVRYCKNNPDGTWAVVDVSLDSLRPSP----VIKCRRRPSGCLIQEMPNGYSK 486
                        ****************************************************************98....7********************* PP

                        EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        vtwvehv++++r++h+l+r+lv+sgla+gak+wv tl+rqce+
  GRMZM2G130442_P01 487 VTWVEHVEVDDRSVHNLYRPLVNSGLAFGAKRWVGTLDRQCER 529
                        *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2387160IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1992162IPR009057Homeodomain-like
PROSITE profilePS5007117.022102162IPR001356Homeobox domain
SMARTSM003896.3E-20103166IPR001356Homeobox domain
PfamPF000464.3E-18105160IPR001356Homeobox domain
CDDcd000861.52E-19105163No hitNo description
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PROSITE profilePS5084838.252298532IPR002913START domain
SuperFamilySSF559617.14E-32299531No hitNo description
CDDcd088756.97E-114302528No hitNo description
SMARTSM002343.2E-56307529IPR002913START domain
PfamPF018526.8E-51308529IPR002913START domain
Gene3DG3DSA:3.30.530.208.0E-7369528IPR023393START-like domain
SuperFamilySSF559612.53E-24551785No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MTPARRVPPA AMIGRNGFAF GSSSALSLSQ ADLLDSHQLQ QAFQQQLFDQ IPTTTTVDDS  60
SDNLIHGRSD TLVDEFESKS CSENPDGTSG DDGLEEDPNQ RPNKKKRYHR HTQHQIQEME  120
AFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK NQHERHENAQ LRAENDKLRA  180
ENMRYKEALG TASCPSCGGP AALGEMSFDE HHLRLENARL RDEIDRISGI AAKHVGKPMV  240
SFPVLSSPLA AAAAAARSPL DLAGAYGVQS AAAGLGADHV LFGAGAGDLL RSVSAGQLDA  300
DKPMIVELAV AAMDELLRMA RPDALLWGGG ASAGAQQQQL DEEEYVRTFP AGLGPRQYGL  360
RPEASRDSAV VIMTCDSLIE ILMDANRFAA VFSSIVSRAS THEVLSTGVA GSYNGALQVM  420
SMEFQVPSPL VPTRESYFVR YCKNNPDGTW AVVDVSLDSL RPSPVIKCRR RPSGCLIQEM  480
PNGYSKVTWV EHVEVDDRSV HNLYRPLVNS GLAFGAKRWV GTLDRQCERL ASAMASNIPN  540
GDLGVITSIE GRKSMLKLAE RMVASFCGGV TASAAHQWTT LSGSGAEDVR VMTRKSVDDP  600
GRPPGIVLNA ATSFWLPVPP KRVFDFLRDE TSRSEWDILS NGGAVQEMAH IANGRDHGNC  660
VSLLRVNSAN SNQSNMLILQ ESCTDASGSY VVYAPVDVVA MNVVLNGGDP DYVALLPSGF  720
AILPDGPPPA GAAPSHGEGL DTGGGGSLLT VAFQILVDSV PTAKLSLGSV ATVNSLIACT  780
VERIKAAVCA EAGNPQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.953480.0ear| embryo| endosperm| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G130442
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G130442_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0663760.0BT066376.1 Zea mays full-length cDNA clone ZM_BFc0032A06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105127.20.0outer cell layer5a
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLC0PDK70.0C0PDK7_MAIZE; HB transcription factor
STRINGGRMZM2G130442_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Ingram GC,Boisnard-Lorig C,Dumas C,Rogowsky PM
    Expression patterns of genes encoding HD-ZipIV homeo domain proteins define specific domains in maize embryos and meristems.
    Plant J., 2000. 22(5): p. 401-14
    [PMID:10849356]
  2. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]